PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g050160.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 654aa    MW: 74495.6 Da    PI: 5.3591
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g050160.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.2e-1947102156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k ++++++q++eLe++++kn++ps+++r+e+A+kl+++ +qV++WFqN+R+++k
  Solyc06g050160.2.1  47 RKKNHRHNADQIKELEAFYKKNPTPSKKTRQEIATKLSMDFNQVQNWFQNKRTQMK 102
                         7888999**********************************************998 PP

2START130.61.9e-411873955203
                         HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
               START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         +a +el+++ + + p+W +      e++n +e+ + f +          +++e  ras +v ++++ lv+ l+d++ qW  +++    k  
  Solyc06g050160.2.1 187 DAFNELFRLYENGNPLWISKLdgsgEMLNIEEYDRLFIP--LidtkpeyFTMEGTRASCIVADTSMALVNMLMDKN-QWVDMFPcivgKTY 274
                         677899999999******999777766666666665544..1447789999*************************.*********88888 PP

                         EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                          ++vis+g      + l l+++e+q +s lv+ R++ f+R+++++ +++w+ivdvS+d+ ++         +++lpSg++++++++g +kv
  Solyc06g050160.2.1 275 ATDVISTGmagnksTSLLLIKTEFQIISDLVSvREVEFLRFCKKHAEDVWAIVDVSIDEIKS---------CRRLPSGCILRDMPDGFCKV 356
                         8899*****************************************************98766.........779***************** PP

                         EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                         tw+eh++++++l+h+ +rsl+k g+a+ga++w a lqrq
  Solyc06g050160.2.1 357 TWIEHTEYNENLVHEWYRSLIKAGMAFGAQRWIASLQRQ 395
                         *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1826105IPR009057Homeodomain-like
SuperFamilySSF466893.8E-1833103IPR009057Homeodomain-like
PROSITE profilePS5007116.35844104IPR001356Homeobox domain
SMARTSM003897.7E-1645108IPR001356Homeobox domain
PfamPF000462.0E-1647102IPR001356Homeobox domain
CDDcd000861.08E-1647105No hitNo description
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PROSITE profilePS5084830.043174401IPR002913START domain
CDDcd088754.16E-87180396No hitNo description
SuperFamilySSF559614.81E-23181395No hitNo description
SMARTSM002341.2E-28183398IPR002913START domain
PfamPF018524.4E-34188395IPR002913START domain
SuperFamilySSF559613.11E-7420647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MEGDSEKSDE SWLKYLIDGS VEGEVSSGDN ITGGASVHEQ GESSSRRKKN HRHNADQIKE  60
LEAFYKKNPT PSKKTRQEIA TKLSMDFNQV QNWFQNKRTQ MKLQSEWYEN KIMKQDNDKL  120
RVEHSVTKEA LENSIREKHS KEKVDENQTK IEHDQLEDEV KRLAYKLSLF NKVVAHDNIV  180
LLNLGLDAFN ELFRLYENGN PLWISKLDGS GEMLNIEEYD RLFIPLIDTK PEYFTMEGTR  240
ASCIVADTSM ALVNMLMDKN QWVDMFPCIV GKTYATDVIS TGMAGNKSTS LLLIKTEFQI  300
ISDLVSVREV EFLRFCKKHA EDVWAIVDVS IDEIKSCRRL PSGCILRDMP DGFCKVTWIE  360
HTEYNENLVH EWYRSLIKAG MAFGAQRWIA SLQRQHHFLK MMKSAVDPTV ELSGERGIRK  420
MAQRMTDMFC TGVCGTKHNW ELIQPATNEN PKLMMRTNVS DPSEYVGVIL SATKTIWLPT  480
QQQTLFKFFN NEQTRSQWDV LYNNSTMERM IQFSKGQNID SNISIYFAHG DESCASRVIL  540
QDTCTDESGS ILVYATIGSQ EMDKVIDGGD SSWVALFSNG IAIAPDCNRN LLAANDTCEE  600
MDNGFEDGSM VTINFQMMGN MLPDTTLSME LVKQANGLIS HTVHKIKSAL KCW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078685.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_015078684.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
TrEMBLK4C5G20.0K4C5G2_SOLLC; Uncharacterized protein
STRINGSolyc06g050160.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1581346
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-165HD-ZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]